DPCfam | MC440991
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Residues in low-complexity regions (%) | 5.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.74 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF03167 |
| Sequences matching dominant architecture (%) | 23.46 |
| Average overlap percent | 54.72 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000947B944 | 308-403 | 96 | MTKTGKNVTPPSLHVTQREPLLSACDTALVEVIRLLQVKTIVGVGRFAQERAQYALKMAGLNIPVLFIMHPSPINPQANKGWAAQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9YGN6-F1 | 181-276 | 100.00 | 97.94 | View in AlphaFoldDB ↗ |