DPCfam | MC44099
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 221 ± 15 aa |
| Residues in low-complexity regions (%) | 2.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.77 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF06082 |
| Sequences matching dominant architecture (%) | 10.53 |
| Average overlap percent | 60.84 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F9XVU8 | 42-244 | 203 | ELVDIPTAGILDYYGFQVKTRAYSGGGVVGGLNFGVLERLNLGTAMMVDRLIGSASPIKMRKPEIQVKFRFFDGGYYIPAAAVGY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P46026-F1 | 210-386 | 73.97 | 90.55 | View in AlphaFoldDB ↗ |