DPCfam | MC440608
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 77 ± 14 aa |
| Residues in low-complexity regions (%) | 5.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 62.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U8J5D5 | 18-81 | 64 | EPEFEEYDPTPYGGGYDLDATYGKPLPPSEGICYPRSSGDPNDQSLKTFSYGSIESPYGKGVDK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0GW88-F1 | 14-96 | 95.45 | 70.62 | View in AlphaFoldDB ↗ |