DPCfam | MC440456
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 260 ± 17 aa |
| Residues in low-complexity regions (%) | 5.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.72 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF17930- PF06230 |
| Sequences matching dominant architecture (%) | 99.34 |
| Average overlap percent | 98.53 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000B39DF38 | 6-273 | 268 | IGLIAGEGKMPVYIAQKATANGYEVYVAGAKGNAKEEDFKTCARVFRAFRLGQLGAGIRFFKEHGVTRVVMAGRVQHTSIFSNLM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9A716-F1 | 4-271 | 99.62 | 93.38 | View in AlphaFoldDB ↗ |