DPCfam | MC440411
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 233 ± 52 aa |
| Residues in low-complexity regions (%) | 5.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A077YY26 | 16-250 | 235 | SDFSFSKSRIVSWLSSETLSSINLRFVRLRNTAKMNFLLAIVHLPKESLEQWRDSLTEILAIASRDADDWIQTVATILSSYVDTR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IBP1-F1 | 9-262 | 99.57 | 80.18 | View in AlphaFoldDB ↗ |