DPCfam | MC440286
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 541 |
|---|---|
| Mean domain length (aa) | 67 ± 10 aa |
| Residues in low-complexity regions (%) | 5.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.84 |
| Average transmembrane regions | 0.92 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U2DZH3 | 108-172 | 65 | IYEYFLERGGIPAEHGQTLLDWGGGSNIVNVILVDFRAFDTMGEISVIAMAALSIITMIAMRQRG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q52978-F1 | 744-808 | 92.86 | 90.30 | View in AlphaFoldDB ↗ |