DPCfam | MC440208
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Residues in low-complexity regions (%) | 0.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14740 |
| Sequences matching dominant architecture (%) | 98.97 |
| Average overlap percent | 41.55 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F0VZ72 | 215-315 | 101 | HASVIHSSQYRMWRNTGIAFEFGDQKYTAPNRTMAAYTEARNRNHSSVLCRGLWTDIIISPYISFGVDTIEAEDSGAEVLFEIQN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1MLB4-F1 | 216-323 | 97.27 | 93.69 | View in AlphaFoldDB ↗ |