DPCfam | MC439895
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 581 |
|---|---|
| Mean domain length (aa) | 273 ± 51 aa |
| Residues in low-complexity regions (%) | 2.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.1 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08235 |
| Sequences matching dominant architecture (%) | 71.4 |
| Average overlap percent | 85.86 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S4D4I6 | 499-813 | 315 | DDSGITSVASGRQWTLWPNPFRRVKTLEDSNYNSSNEEVFVDSESSPMYQSIEQTNITQGGKQSPQEQFVRTNIPTSGQITSLNL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q14693-F1 | 623-854 | 97.89 | 86.77 | View in AlphaFoldDB ↗ |