DPCfam | MC439051
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 555 ± 88 aa |
| Residues in low-complexity regions (%) | 6.19 |
| Residues in coiled-coil regions (%) | 0.26 |
| Predicted disordered residues (%) | 26.16 |
| Average transmembrane regions | 0.13 |
| Dominant Pfam architecture(s) | PF02845 |
| Sequences matching dominant architecture (%) | 81.45 |
| Average overlap percent | 6.98 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A068YB46 | 51-633 | 583 | QWLEDMNTLISYYSNILTSPFDKFWVEVGVLVQCDFRDPKRFAFPKRFVDSVSQLYALVLLILLRASKSTESKDMFLRSFEHENI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A2CEX4-F1 | 55-642 | 99.63 | 77.59 | View in AlphaFoldDB ↗ |