DPCfam | MC43887
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 468 ± 70 aa |
| Residues in low-complexity regions (%) | 11.31 |
| Residues in coiled-coil regions (%) | 11.03 |
| Predicted disordered residues (%) | 33.29 |
| Average transmembrane regions | 0.55 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M9VP74 | 4-366 | 363 | PVVETLVLVSRITRILLGSVLAVGGIALGVWEGMHQYVEYVAMPNAAATAAVTGPSTESAAAMDLLGFDQDMRLQNRLVMPHTDR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZLQ9-F1 | 763-945 | 39.07 | 86.41 | View in AlphaFoldDB ↗ |