DPCfam | MC438843
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Residues in low-complexity regions (%) | 2.43 |
| Residues in coiled-coil regions (%) | 11.86 |
| Predicted disordered residues (%) | 29.27 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00012 |
| Sequences matching dominant architecture (%) | 93.62 |
| Average overlap percent | 11.02 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0V2F4B7 | 62-129 | 68 | LKINPRDADANRAAMARAERCYEMFLGETREHVGMLLSQFEGVLDAQDPRQIDVGRQQLLAALDELEG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P77319-F1 | 486-552 | 94.37 | 90.31 | View in AlphaFoldDB ↗ |