DPCfam | MC438647
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 155 ± 24 aa |
| Residues in low-complexity regions (%) | 1.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00385 |
| Sequences matching dominant architecture (%) | 54.24 |
| Average overlap percent | 33.5 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C3KS39 | 218-366 | 149 | ELICCDRLVNQLSSSGFNVPPDDPRLSLPDVPFFCKRCASGSATTVNTTIGPIDKNACGHRGCTRAIEPGDGEYVIERIIGKRSV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HDV4-F1 | 280-321 | 27.61 | 74.61 | View in AlphaFoldDB ↗ |