DPCfam | MC438320
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 88 ± 5 aa |
| Residues in low-complexity regions (%) | 1.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.36 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00217 |
| Sequences matching dominant architecture (%) | 0.53 |
| Average overlap percent | 2.5 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B3DXR8 | 267-349 | 83 | DQVSRAFGILQNSYIISSKETLNLLSVVRLGIDLGMFPENNRMIIDECLIKIQPAHLQMAYEKKLTSEERDELRADFLREKFK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0AUE7-F1 | 267-353 | 96.67 | 94.86 | View in AlphaFoldDB ↗ |