DPCfam | MC438070
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 521 |
|---|---|
| Mean domain length (aa) | 215 ± 43 aa |
| Residues in low-complexity regions (%) | 1.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.6 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | PF00646 |
| Sequences matching dominant architecture (%) | 2.08 |
| Average overlap percent | 8.51 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0H2RIG9 | 59-335 | 277 | ACTPATMFRLGQVGKLSYTALKDYMKRTFDIDKHFARFFTDPSSFRLLQAETNSVVSGSSALQFLNRQIYPGSDLDLYVDRSEAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1HE06-F1 | 2-219 | 96.12 | 90.86 | View in AlphaFoldDB ↗ |