DPCfam | MC438006
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 64 ± 7 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.08 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF13469 |
| Sequences matching dominant architecture (%) | 97.87 |
| Average overlap percent | 29.95 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146TC87 | 73-138 | 66 | WNEVISMMHNKCVNVGPKQCLPVKYEQLVLHPRTQMQLILQFLGLNWNEQVMHHEQLIGTKISISH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5S6PUA9-F1 | 225-293 | 100.00 | 96.84 | View in AlphaFoldDB ↗ |