DPCfam | MC437712
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 83 ± 13 aa |
| Residues in low-complexity regions (%) | 3.25 |
| Residues in coiled-coil regions (%) | 0.11 |
| Predicted disordered residues (%) | 24.66 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | PF15013 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 80.56 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C9S276 | 27-110 | 84 | ENEPVKFSTSEAARRKLPSVFRNKQAEQMPWYQPYCVVGSVAIFLLYFCVFREENDVDLEFNKTLYDRIKGMEKQQLLQSYRFN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1Z7B8-F1 | 41-126 | 96.63 | 84.92 | View in AlphaFoldDB ↗ |