DPCfam | MC437296
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 261 ± 38 aa |
| Residues in low-complexity regions (%) | 6.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.13 |
| Average transmembrane regions | 0.7 |
| Dominant Pfam architecture(s) | PF13456 |
| Sequences matching dominant architecture (%) | 1.45 |
| Average overlap percent | 0.93 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V4T6J0 | 47-335 | 289 | CARCSVVLSLISKELSLKCVVLLFFSLAVFLSGFFWLLPRSKFQSGFDAKAEIKLSASVQASFRLQKPVSELVPRIGRLEYDIYG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1MDQ0-F1 | 23-304 | 98.95 | 87.45 | View in AlphaFoldDB ↗ |