DPCfam | MC436990
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 501 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Residues in low-complexity regions (%) | 2.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.96 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07745 |
| Sequences matching dominant architecture (%) | 99.24 |
| Average overlap percent | 33.88 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1H7FP38 | 50-147 | 98 | IRGVDISSIISIENAGVKFYNEYGQEQDIFQTLSENGVNYIRIRVWNEPNDGNGHTYGGGNNDVKVAGEIGKRAAKYGMKLLVDI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q65CX5-F1 | 47-147 | 98.06 | 98.76 | View in AlphaFoldDB ↗ |