DPCfam | MC436939
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 62 ± 8 aa |
| Residues in low-complexity regions (%) | 0.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.26 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03837 |
| Sequences matching dominant architecture (%) | 91.18 |
| Average overlap percent | 18.17 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007D8D025 | 6-78 | 73 | TPETTALALSSASAGALLMSDASMDRLERIADLMASGKTTVPAHLRGNKGDCFAICLQSMQWGMNPFSVAQKT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4AAY7-F1 | 31-91 | 98.39 | 88.17 | View in AlphaFoldDB ↗ |