DPCfam | MC436414
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 315 ± 56 aa |
| Residues in low-complexity regions (%) | 7.19 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 29.76 |
| Average transmembrane regions | 0.24 |
| Dominant Pfam architecture(s) | PF07064 |
| Sequences matching dominant architecture (%) | 19.35 |
| Average overlap percent | 5.58 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A2C0299 | 805-1208 | 404 | IDPKDNEMIPRSFNLPNKYGIPHSTPPVSPTEDDLSFVLGTVSLSRTRSQSTTVSQKLASAIQDKSSRIQHQDITRTISEPHNIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q69ZJ7-F1 | 1047-1348 | 95.86 | 60.78 | View in AlphaFoldDB ↗ |