DPCfam | MC43627
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 150 ± 26 aa |
| Residues in low-complexity regions (%) | 5.77 |
| Residues in coiled-coil regions (%) | 15.43 |
| Predicted disordered residues (%) | 35.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03384 |
| Sequences matching dominant architecture (%) | 85.45 |
| Average overlap percent | 34.57 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1P8BDF3 | 11-157 | 147 | MKGFPISELYDTLGTTKEIKSIMLPSPSEKELLKQIMDDEVGHDDVDDMIVDGWTKRIIKENKPICFEELHIQDVSSREIEANPK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1P8BDF3-F1 | 1-162 | 98.18 | 60.62 | View in AlphaFoldDB ↗ |