DPCfam | MC435666
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 70 ± 13 aa |
| Residues in low-complexity regions (%) | 10.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.48 |
| Average transmembrane regions | 0.76 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L8HY78 | 2022-2108 | 86 | KASSVNLVAIVVPISVVTLILVILGSILLVLFVRHKRLQRSFLAYASSHYDPRSERTTFNSAEYLGEDEDSPMITGFSDDEPLVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0DSP1-F1 | 2135-2215 | 100.00 | 36.10 | View in AlphaFoldDB ↗ |