DPCfam | MC435594
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2851 |
|---|---|
| Mean domain length (aa) | 144 ± 19 aa |
| Residues in low-complexity regions (%) | 2.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.06 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02365 |
| Sequences matching dominant architecture (%) | 97.63 |
| Average overlap percent | 84.79 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009014C53 | 6-100 | 95 | IPTGYRFRPTDMELLGFLALFVTGSLSLSWYPMKEKNLYSGEEPWQLFGNSKERIRYYFTPLKKKNPRNSRYRRTIGDGKGTWKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6LWG4-F1 | 578-731 | 97.58 | 86.29 | View in AlphaFoldDB ↗ |