DPCfam | MC43507
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 711 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Residues in low-complexity regions (%) | 2.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03486 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 22.48 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X0U758 | 70-155 | 86 | QISADKYILCSGGRSYPQTGSTGDGYCWAEQLGHAIIPPAPALNPVKTSEKWVKELQGLSLKNVSLKLFQNGKKQNERFGEMLFT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FXH5-F1 | 156-239 | 97.53 | 97.26 | View in AlphaFoldDB ↗ |