DPCfam | MC43429
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 111 ± 10 aa |
| Residues in low-complexity regions (%) | 8.24 |
| Residues in coiled-coil regions (%) | 1.76 |
| Predicted disordered residues (%) | 2.83 |
| Average transmembrane regions | 3.07 |
| Dominant Pfam architecture(s) | PF13536 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 45.78 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G8TZK3 | 206-309 | 104 | MTLGSLPFWLAVAVWGYLRAGWPTTGQLVQSILVALSSGVIATLLFYWATEKAYARPDQLAAVEATQSAEVVFAAIGAVLILGQP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O34428-F1 | 193-305 | 99.12 | 91.49 | View in AlphaFoldDB ↗ |