DPCfam | MC434252
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 611 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Residues in low-complexity regions (%) | 10.77 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 5.89 |
| Average transmembrane regions | 1.96 |
| Dominant Pfam architecture(s) | PF01741 |
| Sequences matching dominant architecture (%) | 98.36 |
| Average overlap percent | 92.63 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A093VAL4 | 23-134 | 112 | WDCFWDFALRDNVLEVAIGLIIAAAFTKVVNSFVSDLFLPIISLLPFLNRNLEDKFAVLSKGKHYSDWGPDGYNTLEQARDDGAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A4IMP7-F1 | 1-113 | 95.90 | 85.30 | View in AlphaFoldDB ↗ |