DPCfam | MC434234
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Residues in low-complexity regions (%) | 1.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.26 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00144 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 12.23 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S5Y3D1 | 29-86 | 58 | LPMAEPESVGMSAERLQRIDAFTQRYIDNEMVAGTVTLVARRGKVVHFSAQGMKDVER... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8XBJ0-F1 | 25-77 | 93.10 | 98.21 | View in AlphaFoldDB ↗ |