DPCfam | MC434216
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 119 ± 24 aa |
| Residues in low-complexity regions (%) | 0.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00034 |
| Sequences matching dominant architecture (%) | 8.37 |
| Average overlap percent | 62.4 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B7KHY1 | 488-585 | 98 | KSGAVYWASPLQGIFASSPYFHNGSVPTLRDVLSPPEQRPTTFLTGSNSFDPKNVGLKNEGYFTYNTTEKGKGNGGHPFGTQLPP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I237-F1 | 525-624 | 95.65 | 95.74 | View in AlphaFoldDB ↗ |