DPCfam | MC434075
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 371 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Residues in low-complexity regions (%) | 1.56 |
| Residues in coiled-coil regions (%) | 0.33 |
| Predicted disordered residues (%) | 29.62 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05853 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 27.7 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J5CTV7 | 238-295 | 58 | MILGCDIIRVGLEDNIYLSKGVPVKSNAELVEKAVRIAKELGRYIATVDEAKEILGLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8RHX2-F1 | 213-271 | 98.33 | 98.02 | View in AlphaFoldDB ↗ |