DPCfam | MC433822
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 107 ± 16 aa |
| Residues in low-complexity regions (%) | 3.05 |
| Residues in coiled-coil regions (%) | 1.01 |
| Predicted disordered residues (%) | 16.91 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00076FC693 | 3095-3190 | 95 | QYKNLLDSMVATWRDVLKFSEATDSKVIILSLWHAHVHKHYGRYLKLLTRYYEDKPLKEIDEKCIDLAKTLGWNHWACHLNTFIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A5PK39-F1 | 1151-1249 | 97.06 | 87.36 | View in AlphaFoldDB ↗ |