DPCfam | MC433815
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Residues in low-complexity regions (%) | 1.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.62 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06870 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 36.47 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X2HQC0 | 44-116 | 73 | PADTTFHAYRSYDETKDQQRYVRGETEKVEFAGANFGEQAASNLYCKYLVGVYSKSDQTLTVAPAPLMRMRPR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9GZS1-F1 | 22-136 | 99.13 | 83.53 | View in AlphaFoldDB ↗ |