DPCfam | MC433363
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 441 ± 47 aa |
| Residues in low-complexity regions (%) | 18.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 75.26 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00627 |
| Sequences matching dominant architecture (%) | 28.99 |
| Average overlap percent | 7.81 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T5BAF9 | 1-440 | 440 | MDDLSGLSWNLSAGSEARRPAPVGSTLAAAFSDLRPTPPTSGRSTPVTVGPSVRSKPPSKTATPVNDSFANLVTFSSSNSGKSLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PJP5-F1 | 1-516 | 99.77 | 53.47 | View in AlphaFoldDB ↗ |