DPCfam | MC43318
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 257 ± 52 aa |
| Residues in low-complexity regions (%) | 2.67 |
| Residues in coiled-coil regions (%) | 0.14 |
| Predicted disordered residues (%) | 23.67 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00498 |
| Sequences matching dominant architecture (%) | 88.14 |
| Average overlap percent | 18.85 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A150RCJ8 | 40-304 | 265 | HARLSYRDGAWSVRDLGSKNGTFVNGERLAAGSARALAAGDLLAFGDPEATWTLVDASPPVPMARRLSDNALLAGAGALLALPSA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EPJ9-F1 | 40-91 | 19.34 | 86.50 | View in AlphaFoldDB ↗ |