DPCfam | MC433142
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 205 ± 32 aa |
| Residues in low-complexity regions (%) | 1.81 |
| Residues in coiled-coil regions (%) | 2.91 |
| Predicted disordered residues (%) | 16.7 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18198- PF18199 |
| Sequences matching dominant architecture (%) | 0.67 |
| Average overlap percent | 36.9 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M0JEX6 | 416-647 | 232 | GHRPLFVLKMQVEGESFKFTPNLPTLLKTVLGAVDHFVAMLNTIPRIEAEMGRTGGGQARLITVATVDDEVIVNAKARLHELVEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DMI6-F1 | 543-738 | 99.49 | 78.23 | View in AlphaFoldDB ↗ |