DPCfam | MC432073
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 353 ± 36 aa |
| Residues in low-complexity regions (%) | 11.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.67 |
| Average transmembrane regions | 5.33 |
| Dominant Pfam architecture(s) | PF00924 |
| Sequences matching dominant architecture (%) | 98.68 |
| Average overlap percent | 19.06 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0U5IKL8 | 80-467 | 388 | ILRADIGGISPSDRVRRIQGKIADVLANNPGENAEAIRSTFANLAGFWVQIDGHPVLGLVPEDADTMTGETFDEQVRRAVDLLQE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GMV6-F1 | 37-401 | 99.73 | 86.94 | View in AlphaFoldDB ↗ |