DPCfam | MC431949
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 163 ± 22 aa |
| Residues in low-complexity regions (%) | 2.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.74 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF02635 |
| Sequences matching dominant architecture (%) | 0.99 |
| Average overlap percent | 77.1 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F8FRK8 | 1-175 | 175 | MDASIRTWLAELESADKNVQFEALQNLLAATDTKVDWAYEMWGPLLGWLTDRDNHRRSRAAQLLSNLARSDPDQRMLADFSKLWA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6L2K8-F1 | 1288-1365 | 43.18 | 84.50 | View in AlphaFoldDB ↗ |