DPCfam | MC431937
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 481 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Residues in low-complexity regions (%) | 9.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.2 |
| Average transmembrane regions | 3.53 |
| Dominant Pfam architecture(s) | PF08570 |
| Sequences matching dominant architecture (%) | 98.01 |
| Average overlap percent | 94.01 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L9SM02 | 148-292 | 145 | SLHYLPPVKPSAIAVGLAFSQSVELAVLAPIFGQTYQRAKAASTKEEFLRSREAAGAASAWGTSFVGAAMQAYGVAALINATGTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9UTI9-F1 | 11-140 | 97.64 | 80.07 | View in AlphaFoldDB ↗ |