DPCfam | MC431778
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 232 ± 53 aa |
| Residues in low-complexity regions (%) | 6.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.34 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067PGV0 | 62-375 | 314 | TFEETSRRISSLYEGVIFDDDAEDDCGGAYGQEAELDLGDEERNGAGIDKPAAADQTTLISWPPTPQPDLTTTSSFDNSESRPNI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q86V20-F1 | 419-518 | 44.00 | 80.30 | View in AlphaFoldDB ↗ |