DPCfam | MC431713
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 401 |
|---|---|
| Mean domain length (aa) | 115 ± 17 aa |
| Residues in low-complexity regions (%) | 1.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11736 |
| Sequences matching dominant architecture (%) | 92.59 |
| Average overlap percent | 86.05 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A062363 | 143-247 | 105 | QIGTFNTVKELDGMKVRLPGYTVPFEYGKDANIREFLLVPYYGACLHAPPPPPNQTVFVKAEKEIKLKDLSQAVWIEGTLRTQTQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HWW2-F1 | 62-164 | 88.50 | 95.10 | View in AlphaFoldDB ↗ |