DPCfam | MC431621
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Residues in low-complexity regions (%) | 1.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A178LHW6 | 5-97 | 93 | RVAHVAEAALAEQQFVTPIDVLVGLGWLDEAKADLWRAGFVSSLDRCLRAKPIEVAEAVKALGTWALDRDLKPWVTDYGNLAFTA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P71649-F1 | 6-118 | 99.13 | 93.01 | View in AlphaFoldDB ↗ |