DPCfam | MC431592
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 182 ± 28 aa |
| Residues in low-complexity regions (%) | 4.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05603 |
| Sequences matching dominant architecture (%) | 94.17 |
| Average overlap percent | 94.99 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T2MCT0 | 9-194 | 186 | IVPGRLVQFVYQQISDAQIVFLLPNCESINHLVIFLTGSQPFPEGYAASIYLCWPNSEVAWHMLGFVSNDKPSAVFKIAKPKNSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7PRB5-F1 | 7-199 | 100.00 | 81.12 | View in AlphaFoldDB ↗ |