DPCfam | MC431230
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 392 ± 52 aa |
| Residues in low-complexity regions (%) | 4.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.94 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00093 |
| Sequences matching dominant architecture (%) | 32.76 |
| Average overlap percent | 17.45 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067RCG0 | 2-404 | 403 | QKKRRVVARVHCRNIKNECPKPSCDEPVLHPGRCCKVCSGDFNSPDVLHDIPSVLTPEEEERNMKHFATLLTGRTSSVFHRDDGL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O57472-F1 | 44-454 | 100.00 | 81.90 | View in AlphaFoldDB ↗ |