DPCfam | MC43119
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Residues in low-complexity regions (%) | 28.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.0 |
| Average transmembrane regions | 2.85 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G7N1J1 | 316-422 | 107 | GVVGGALAFLVGPPLMQVLFGADYRVGGLELAAMTFASAGTALLTISGALCQALKRHGVFVAGWLVALAVSLAVLVSGLDMSARV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P9WLW0-F1 | 332-429 | 98.00 | 95.41 | View in AlphaFoldDB ↗ |