DPCfam | MC431138
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 89 ± 12 aa |
| Residues in low-complexity regions (%) | 0.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.37 |
| Average transmembrane regions | 0.18 |
| Dominant Pfam architecture(s) | PF01061 |
| Sequences matching dominant architecture (%) | 55.38 |
| Average overlap percent | 11.06 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A166HHY1 | 234-314 | 81 | PYNYISAQDFKRKFRDFYVGKNLYNEFSHPTDKIEIQKSPLSFNTGSVKNLELFKACMAREWLLMKRNSFVHVFKSVQLVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O24367-F1 | 439-537 | 99.00 | 87.19 | View in AlphaFoldDB ↗ |