DPCfam | MC43103
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 179 ± 27 aa |
| Residues in low-complexity regions (%) | 12.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 63.6 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00069 |
| Sequences matching dominant architecture (%) | 2.38 |
| Average overlap percent | 1.83 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009E2B239 | 275-487 | 213 | VNDAFKQSEDWHIEQQMLADKLRCTDWEATNEAMEEAVARESYLEWLRDREKRARGTRTLPRSSPTATSSTSTCTESKRPTSPHH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QPN8-F1 | 341-526 | 98.93 | 60.72 | View in AlphaFoldDB ↗ |