DPCfam | MC431027
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Residues in low-complexity regions (%) | 2.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18152- PF00793 |
| Sequences matching dominant architecture (%) | 51.14 |
| Average overlap percent | 35.68 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000401B410 | 1-86 | 86 | MIILMARQADEQQIEAVVARIRAAGLTEHVSRGSERILIGAIGDERTISPEHFEQLPGVERAMRVLKEYRMIAQAAKPDSVQVRI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9WYH8-F1 | 1-92 | 98.92 | 91.83 | View in AlphaFoldDB ↗ |