DPCfam | MC430948
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 114 ± 19 aa |
| Residues in low-complexity regions (%) | 3.58 |
| Residues in coiled-coil regions (%) | 3.04 |
| Predicted disordered residues (%) | 27.35 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF08016 |
| Sequences matching dominant architecture (%) | 88.31 |
| Average overlap percent | 4.16 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E2RMB4 | 484-621 | 137 | NMFLAIINDTYSEVKADYSIGRRPDFELGKMIKKSYNNALEKLRLKKPEQDEDISMKGDLAEQARREGFDENEIQSAEQMKKWKD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9P0L9-F1 | 554-673 | 100.00 | 77.84 | View in AlphaFoldDB ↗ |