DPCfam | MC430492
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 277 ± 53 aa |
| Residues in low-complexity regions (%) | 5.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.99 |
| Average transmembrane regions | 0.14 |
| Dominant Pfam architecture(s) | PF14228 |
| Sequences matching dominant architecture (%) | 18.89 |
| Average overlap percent | 6.79 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151J1N4 | 772-1063 | 292 | NALTSPSIRAKEQSVDTTRVNIRVDVSIKKCETGQKIEPVSNIFYLVEGFALVMLCNCRLYPRRLAVHILREIKLLLKTLGGPED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044V8Y5-F1 | 701-956 | 98.08 | 68.33 | View in AlphaFoldDB ↗ |