DPCfam | MC430314
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 118 ± 14 aa |
| Residues in low-complexity regions (%) | 1.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.43 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF06682 |
| Sequences matching dominant architecture (%) | 93.86 |
| Average overlap percent | 57.6 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G4MRA6 | 29-99 | 71 | NAILLSQVKMLTLRGDGAQTTHRRLPAVPQLKCLSAPKLCALHPIDVLRCTNQGSGYDAEDVQWSCAANLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F7C1E2-F1 | 32-143 | 97.35 | 95.65 | View in AlphaFoldDB ↗ |