DPCfam | MC430271
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 158 ± 20 aa |
| Residues in low-complexity regions (%) | 3.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.22 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF05683 |
| Sequences matching dominant architecture (%) | 99.12 |
| Average overlap percent | 91.57 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G2DAY8 | 77-239 | 163 | WRPGERILLSGKLLTGRDAAHKRIADLLTRGEPLPDGVDLRNRFIYYVGPVDPVGDEVVGPAGPTTASRMDKFSEMMLGELGLIG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58034-F1 | 12-181 | 99.40 | 97.83 | View in AlphaFoldDB ↗ |